PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g033990.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28593.4 Da    PI: 8.2916
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g033990.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.74.9e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  Sopen02g033990.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCS 59
                      79***********************************************96 PP

2K-box91.12e-30781744100
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                        + ++  + +++s+++e+ kLk+++e+Lqr qRhllG++L++L++ +L++Le qL++slk+iRs++++++l+q+++lq kek  +e+nk L++
  Sopen02g033990.2  78 LEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLER 170
                       56666677889*********************************************************************************9 PP

             K-box  97 klee 100
                       k +e
  Sopen02g033990.2 171 KQME 174
                       9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
CDDcd002658.20E-44278No hitNo description
SuperFamilySSF554552.35E-33278IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014865.5E-2585171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.90888179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALLVFSN RGKLYEFCST  60
NNMLKTLDRY QKCSYGTLEV NRSIKDNEQS SYREYLKLKA KYESLQRYQR HLLGDELGPL  120
TIDDLEHLEV QLDTSLKHIR STRTQMMLDQ LSDLQTKEKL WNEANKVLER KQMEEIYAEN  180
NMQQAWGGGE QSLNYGQQQH PQSQGFFQPL ECNSSLQIGF DPITTSSQIT AVTNAQNVNG  240
MIPGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D2e-2775168197Developmental protein SEPALLATA 3
4ox0_C2e-2775168197Developmental protein SEPALLATA 3
4ox0_B2e-2775168197Developmental protein SEPALLATA 3
4ox0_A2e-2775168197Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3020150.0AJ302015.1 Lycopersicon esculentum mRNA for MADS-box protein (TM29 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015064043.10.0PREDICTED: developmental protein SEPALLATA 1-like isoform X1
SwissprotP293841e-104SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLQ8VXG00.0Q8VXG0_SOLLC; MADS-box protein
STRINGSolyc02g089200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.15e-99MIKC_MADS family protein